esm-protein-language-model

What problem does it solve?

This Skill enables the design of novel proteins, prediction of their structures, and extraction of meaningful representations for machine learning tasks, streamlining protein engineering and discovery workflows.

Core Features & Use Cases

• Protein Sequence Generation: Create new protein sequences with desired functions or structures.
• Structure Prediction: Predict the 3D atomic coordinates of a protein from its amino acid sequence.
• Inverse Folding: Design amino acid sequences that will fold into a specific target 3D structure.
• Protein Embeddings: Generate fixed-length vector representations of proteins for downstream machine learning tasks like classification or clustering.
• Use Case: A researcher wants to design a new enzyme with a specific catalytic activity. They can use this Skill to generate candidate sequences, predict their structures, and then use the embeddings to cluster similar designs.

Quick Start

Use the esm-protein-language-model skill to generate a protein sequence for the provided amino acid sequence "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN".